Lineage for d1cn4b1 (1cn4 B:8-116)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2371768Protein Erythropoietin (EPO) receptor [49282] (1 species)
  7. 2371769Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries)
  8. 2371788Domain d1cn4b1: 1cn4 B:8-116 [22029]
    Other proteins in same PDB: d1cn4c_

Details for d1cn4b1

PDB Entry: 1cn4 (more details), 2.8 Å

PDB Description: erythropoietin complexed with extracellular domains of erythropoietin receptor
PDB Compounds: (B:) protein (erythropoietin receptor)

SCOPe Domain Sequences for d1cn4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cn4b1 b.1.2.1 (B:8-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
dpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqledepwklc
rlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

SCOPe Domain Coordinates for d1cn4b1:

Click to download the PDB-style file with coordinates for d1cn4b1.
(The format of our PDB-style files is described here.)

Timeline for d1cn4b1: