SCOP 1.73: Domain d1ernb1: 1ern B:10-116

Lineage for d1ernb1 (1ern B:10-116)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Erythropoietin (EPO) receptor [49282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)

8. Domain d1ernb1: 1ern B:10-116 [22021]

Details for d1ernb1

PDB Entry: 1ern, 2.4 Å

PDB Description: native structure of the extracellular domain of erythropoietin (epo) receptor [ebp]

PDB Compounds: (B:) protein (erythropoietin receptor)

SCOP Domain Sequences for d1ernb1:

Sequence, based on SEQRES records:

>d1ernb1 b.1.2.1 (B:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
kfeskaallaargpeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrl
hqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

Sequence, based on observed residues (ATOM records):

>d1ernb1 b.1.2.1 (B:10-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
kfeskaallaaeellcfterledlvcfweeaasagvgpgnysfsyqledepwklcrlhqa
ptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

Timeline for d1ernb1:

• d1ernb1 first appeared (with stable ids) in SCOP 1.55
  
• d1ernb1 appears in SCOP 1.71
  
• d1ernb1 appears in SCOP 1.75
  
• d1ernb1 appears in the current release, SCOPe 2.08