SCOPe 2.02: Domain d1ebab2: 1eba B:117-220

Lineage for d1ebab2 (1eba B:117-220)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Erythropoietin (EPO) receptor [49282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries)

8. Domain d1ebab2: 1eba B:117-220 [22018]

Details for d1ebab2

PDB Entry: 1eba, 2.7 Å

PDB Description: complex between the extracellular domain of erythropoietin (epo) receptor [ebp] and an inactive peptide [emp33] contains 3,5-dibromotyrosine in position 4 (denoted dby)

PDB Compounds: (B:) protein (erythropoietin receptor)

SCOPe Domain Sequences for d1ebab2:

Sequence, based on SEQRES records:

>d1ebab2 b.1.2.1 (B:117-220) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagngagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsawsepvsllt

Sequence, based on observed residues (ATOM records):

>d1ebab2 b.1.2.1 (B:117-220) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
evvlldapvglvarlasghvvlrwlpppetpmtshiryevdvsagngsvqrveilegrte
cvlsnlrgrtrytfavrarmaepsfggfwsawsepvsllt

Timeline for d1ebab2:

• d1ebab2 first appeared (with stable ids) in SCOP 1.55
  
• d1ebab2 appears in SCOPe 2.01
  
• d1ebab2 appears in SCOPe 2.03
  
• d1ebab2 appears in the current release, SCOPe 2.08