Lineage for d4dzbb1 (4dzb B:2-117)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2032206Domain d4dzbb1: 4dzb B:2-117 [220121]
    Other proteins in same PDB: d4dzba2, d4dzbb2
    automated match to d1ktke1

Details for d4dzbb1

PDB Entry: 4dzb (more details), 1.7 Å

PDB Description: Mucosal-associated invariant T cell receptor, Valpha7.2Jalpha33-Vbeta2
PDB Compounds: (B:) Vbeta2 (MAIT T cell receptor)

SCOPe Domain Sequences for d4dzbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dzbb1 b.1.1.0 (B:2-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avvsqhpswvisksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsnegskatyeqg
vekdkflinhasltlstltvtsahpedssfyicsartsgdfgeqffgpgtrltvle

SCOPe Domain Coordinates for d4dzbb1:

Click to download the PDB-style file with coordinates for d4dzbb1.
(The format of our PDB-style files is described here.)

Timeline for d4dzbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dzbb2