SCOPe 2.07: Domain d1eerb1: 1eer B:8-116

Lineage for d1eerb1 (1eer B:8-116)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Erythropoietin (EPO) receptor [49282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries)

8. Domain d1eerb1: 1eer B:8-116 [22011]
   Other proteins in same PDB: d1eera_

Details for d1eerb1

PDB Entry: 1eer, 1.9 Å

PDB Description: crystal structure of human erythropoietin complexed to its receptor at 1.9 angstroms

PDB Compounds: (B:) erythropoietin receptor

SCOPe Domain Sequences for d1eerb1:

Sequence; same for both SEQRES and ATOM records:

>d1eerb1 b.1.2.1 (B:8-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
dpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqledepwklc
rlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

Timeline for d1eerb1:

• d1eerb1 first appeared (with stable ids) in SCOP 1.55
  
• d1eerb1 appears in SCOPe 2.06
  
• d1eerb1 appears in the current release, SCOPe 2.08