SCOPe 2.05: Domain d4dxeb_: 4dxe B:

Lineage for d4dxeb_ (4dxe B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.0: automated matches [191589] (1 protein)
   not a true family

6. Protein automated matches [191061] (9 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [226319] (3 PDB entries)

8. Domain d4dxeb_: 4dxe B: [220088]
   Other proteins in same PDB: d4dxeg_, d4dxeh_, d4dxei_, d4dxej_, d4dxek_, d4dxel_
   automated match to d3hyka_
   complexed with mli

Details for d4dxeb_

PDB Entry: 4dxe, 2.51 Å

PDB Description: 2.52 angstrom resolution crystal structure of the acyl-carrier-protein synthase (acps)-acyl carrier protein (acp) protein-protein complex from staphylococcus aureus subsp. aureus col

PDB Compounds: (B:) acyl-carrier-protein synthase

SCOPe Domain Sequences for d4dxeb_:

Sequence, based on SEQRES records:

>d4dxeb_ d.150.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93062]}
amihgigvdlieidriqalyskqpklveriltkneqhkfnnftheqrkieflagrfatke
afskalgtglgkhvafndidcyndelgkpkidyegfivhvsishtehyamsqvvleks

Sequence, based on observed residues (ATOM records):

>d4dxeb_ d.150.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93062]}
amihgigvdlieidriqalyskqpklveriltkneqhkfnnftheqrkieflagrfatke
afskalgtgvafndidcyndkpkidyegfivhvsishtehyamsqvvleks

Timeline for d4dxeb_:

• d4dxeb_ first appeared in SCOPe 2.03
  
• d4dxeb_ appears in SCOPe 2.04
  
• d4dxeb_ is called d4dxeb1 in SCOPe 2.06
  
• d4dxeb_ appears in the current release, SCOPe 2.08, called d4dxeb1