SCOPe 2.06: Domain d3hhrc2: 3hhr C:131-236

Lineage for d3hhrc2 (3hhr C:131-236)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Growth hormone receptor [49280] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49281] (6 PDB entries)
   tandem of fibronectin type III domains

8. Domain d3hhrc2: 3hhr C:131-236 [22008]
   Other proteins in same PDB: d3hhra_

Details for d3hhrc2

PDB Entry: 3hhr, 2.8 Å

PDB Description: human growth hormone and extracellular domain of its receptor: crystal structure of the complex

PDB Compounds: (C:) HUMAN GROWTH HORMONE RECEPTOR (hGHbp)

SCOPe Domain Sequences for d3hhrc2:

Sequence; same for both SEQRES and ATOM records:

>d3hhrc2 b.1.2.1 (C:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
pdppialnwtllnvsltgihadiqvrweaprnadiqkgwmvleyelqykevnetkwkmmd
pilttsvpvyslkvdkeyevrvrskqrnsgnygefsevlyvtlpqm

Timeline for d3hhrc2:

• d3hhrc2 first appeared (with stable ids) in SCOP 1.55
  
• d3hhrc2 appears in SCOPe 2.05
  
• d3hhrc2 appears in SCOPe 2.07
  
• d3hhrc2 appears in the current release, SCOPe 2.08