SCOP 1.65: Domain d1cfb_1: 1cfb 610-709

Lineage for d1cfb_1 (1cfb 610-709)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (20 proteins)

6. Protein Neuroglian, two amino proximal Fn3 repeats [49276] (1 species)
   tandem of fibronectin type III domains

7. Species Drosophila melanogaster [TaxId:7227] [49277] (1 PDB entry)

8. Domain d1cfb_1: 1cfb 610-709 [21991]

Details for d1cfb_1

PDB Entry: 1cfb, 2 Å

PDB Description: crystal structure of tandem type iii fibronectin domains from drosophila neuroglian at 2.0 angstroms

SCOP Domain Sequences for d1cfb_1:

Sequence; same for both SEQRES and ATOM records:

>d1cfb_1 b.1.2.1 (610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster}
ivqdvpnapkltgitcqadkaeihweqqgdnrspilhytiqfntsftpaswdaayekvpn
tdssfvvqmspwanytfrviafnkigasppsahsdscttq

Timeline for d1cfb_1:

• d1cfb_1 first appeared (with stable ids) in SCOP 1.55
  
• d1cfb_1 appears in SCOP 1.63
  
• d1cfb_1 appears in SCOP 1.67
  
• d1cfb_1 appears in the current release, SCOPe 2.08, called d1cfba1