SCOP 1.73: Domain d2hfta2: 2hft A:107-211

Lineage for d2hfta2 (2hft A:107-211)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries)

8. Domain d2hfta2: 2hft A:107-211 [21952]
   complexed with so4

Details for d2hfta2

PDB Entry: 2hft, 1.69 Å

PDB Description: the crystal structure of the extracellular domain of human tissue factor at 1.7 angstroms resolution

PDB Compounds: (A:) human tissue factor

SCOP Domain Sequences for d2hfta2:

Sequence, based on SEQRES records:

>d2hfta2 b.1.2.1 (A:107-211) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywksssqekg
efrsgkktaktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

Sequence, based on observed residues (ATOM records):

>d2hfta2 b.1.2.1 (A:107-211) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssgkkta
ktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

Timeline for d2hfta2:

• d2hfta2 first appeared (with stable ids) in SCOP 1.55, called d2hft_2
  
• d2hfta2 was called d2hft_2 in SCOP 1.71
  
• d2hfta2 appears in SCOP 1.75
  
• d2hfta2 appears in the current release, SCOPe 2.08