Lineage for d2hft_2 (2hft 107-211)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 9780Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 9781Family b.1.2.1: Fibronectin type III [49266] (14 proteins)
  6. 9815Protein Extracellular region of human tissue factor [49267] (2 species)
  7. 9816Species Human (Homo sapiens) [TaxId:9606] [49268] (6 PDB entries)
  8. 9818Domain d2hft_2: 2hft 107-211 [21952]

Details for d2hft_2

PDB Entry: 2hft (more details), 1.69 Å

PDB Description: the crystal structure of the extracellular domain of human tissue factor at 1.7 angstroms resolution

SCOP Domain Sequences for d2hft_2:

Sequence, based on SEQRES records: (download)

>d2hft_2 b.1.2.1 (107-211) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywksssqekg
efrsgkktaktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

Sequence, based on observed residues (ATOM records): (download)

>d2hft_2 b.1.2.1 (107-211) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssgkkta
ktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

SCOP Domain Coordinates for d2hft_2:

Click to download the PDB-style file with coordinates for d2hft_2.
(The format of our PDB-style files is described here.)

Timeline for d2hft_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hft_1