Lineage for d4b5ya_ (4b5y A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1643322Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1643323Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1643324Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1643577Protein automated matches [190406] (14 species)
    not a true protein
  7. 1643739Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (38 PDB entries)
  8. 1643752Domain d4b5ya_: 4b5y A: [219338]
    automated match to d2ye1a_
    mutant

Details for d4b5ya_

PDB Entry: 4b5y (more details), 1.45 Å

PDB Description: x-ray structure of the cyan fluorescent protein mturquoise-gl (k206a mutant) in space group c222(1)
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d4b5ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b5ya_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
mvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
lvttlxvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynyisgnvyitadkqkngikanfkirhniedggvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefltaagitl

SCOPe Domain Coordinates for d4b5ya_:

Click to download the PDB-style file with coordinates for d4b5ya_.
(The format of our PDB-style files is described here.)

Timeline for d4b5ya_: