![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein automated matches [190406] (14 species) not a true protein |
![]() | Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (38 PDB entries) |
![]() | Domain d2ye1a_: 2ye1 A: [195591] automated match to d3st3a_ complexed with mg; mutant |
PDB Entry: 2ye1 (more details), 1.63 Å
SCOPe Domain Sequences for d2ye1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ye1a_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]} kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt tlxvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnrie lkgidfkedgnilghkleynyisgnvyitadkqkngikanfkirhniedggvqladhyqq ntpigdgpvllpdnhylstqsalskdpnekrdhmvllefltaagit
Timeline for d2ye1a_: