Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins) subgroup of the larger IPT/TIG domain family |
Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [49250] (8 PDB entries) |
Domain d1vkxb1: 1vkx B:547-650 [21931] Other proteins in same PDB: d1vkxa1, d1vkxa2, d1vkxb2 protein/DNA complex |
PDB Entry: 1vkx (more details), 2.9 Å
SCOP Domain Sequences for d1vkxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vkxb1 b.1.18.1 (B:547-650) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus)} nlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrq faivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype
Timeline for d1vkxb1: