![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) ![]() |
![]() | Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
![]() | Protein automated matches [190048] (21 species) not a true protein |
![]() | Species Shewanella oneidensis [TaxId:211586] [187764] (9 PDB entries) |
![]() | Domain d4awua_: 4awu A: [219188] automated match to d2gqaa_ complexed with 4ch, fmn, pe4, so4; mutant |
PDB Entry: 4awu (more details), 1.69 Å
SCOPe Domain Sequences for d4awua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4awua_ c.1.4.0 (A:) automated matches {Shewanella oneidensis [TaxId: 211586]} tqslfqpitlgaltlknrivmppltrsrasqpgdvanhmmaiyyaqrasaglivsegtqi sptakgyawtpgiytpeqiagwrivteavhakgcaifaqlwhvgrvthpdnidgqqpiss stlkaenvkvfvdngsdepgfvdvavpramtkadiaqviadyrqaalnameagfdgielh aangylinqfidseannrsdeyggslenrlrfldevvaalvdaigaervgvrlaplttln gtvdadpiltytaaaallnkhrivylhiaevdwddapdtpvsfkralreayqgvliyagr ynaekaeqaindgladmigfgrpfianpdlperlrhgyplaehvpatlfgggekgltdyp tyqa
Timeline for d4awua_: