Lineage for d4awta_ (4awt A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2091323Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2091860Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2091861Protein automated matches [190048] (21 species)
    not a true protein
  7. 2091981Species Shewanella oneidensis [TaxId:211586] [187764] (9 PDB entries)
  8. 2091982Domain d4awta_: 4awt A: [219187]
    automated match to d2gqaa_
    complexed with 01f, bog, fmn, pe4, so4; mutant

Details for d4awta_

PDB Entry: 4awt (more details), 0.98 Å

PDB Description: crystal structure of the reduced shewanella yellow enzyme 1 (sye1) m25l mutant
PDB Compounds: (A:) sye1

SCOPe Domain Sequences for d4awta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4awta_ c.1.4.0 (A:) automated matches {Shewanella oneidensis [TaxId: 211586]}
xqslfqpitlgaltlknrivmppltrsrasqpgdvanhmmaiyyaqrasaglivsegtqi
sptakgyawtpgiytpeqiagwrivteavhakgcaifaqlwhvgrvthpdnidgqqpiss
stlkaenvkvfvdngsdepgfvdvavpramtkadiaqviadyrqaalnameagfdgielh
aangylinqfidseannrsdeyggslenrlrfldevvaalvdaigaervgvrlaplttln
gtvdadpiltytaaaallnkhrivylhiaevdwddapdtpvsfkralreayqgvliyagr
ynaekaeqaindgladmigfgrpfianpdlperlrhgyplaehvpatlfgggekgltdyp
tyqa

SCOPe Domain Coordinates for d4awta_:

Click to download the PDB-style file with coordinates for d4awta_.
(The format of our PDB-style files is described here.)

Timeline for d4awta_: