Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.9: SAH/MTA deaminase-like [82258] (3 proteins) automatically mapped to Pfam PF01979 |
Protein Guanine deaminase [159391] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [159394] (2 PDB entries) Uniprot Q9Y2T3 76-388 |
Domain d4aqla2: 4aql A:76-388 [219111] Other proteins in same PDB: d4aqla1 automated match to d2uz9a2 complexed with txc, zn |
PDB Entry: 4aql (more details), 1.99 Å
SCOPe Domain Sequences for d4aqla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aqla2 c.1.9.9 (A:76-388) Guanine deaminase {Human (Homo sapiens) [TaxId: 9606]} pglvdthihasqysfagssidlpllewltkytfpaehrfqnidfaeevytrvvrrtlkng tttacyfatihtdssllladitdkfgqrafvgkvcmdlndtfpeyketteesiketerfv semlqknysrvkpivtprfslscsetlmgelgniaktrdlhiqshisenrdeveavknly psyknytsvydknnlltnktvmahgcylsaeelnvfhergasiahcpnsnlslssgflnv levlkhevkiglgtdvaggysysmldairravmvsnillinkvneksltlkevfrlatlg gsqalgldgeign
Timeline for d4aqla2: