Lineage for d4aqla2 (4aql A:76-388)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833861Family c.1.9.9: SAH/MTA deaminase-like [82258] (3 proteins)
    automatically mapped to Pfam PF01979
  6. 2833862Protein Guanine deaminase [159391] (3 species)
  7. 2833868Species Human (Homo sapiens) [TaxId:9606] [159394] (2 PDB entries)
    Uniprot Q9Y2T3 76-388
  8. 2833869Domain d4aqla2: 4aql A:76-388 [219111]
    Other proteins in same PDB: d4aqla1
    automated match to d2uz9a2
    complexed with txc, zn

Details for d4aqla2

PDB Entry: 4aql (more details), 1.99 Å

PDB Description: human guanine deaminase in complex with valacyclovir
PDB Compounds: (A:) guanine deaminase

SCOPe Domain Sequences for d4aqla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aqla2 c.1.9.9 (A:76-388) Guanine deaminase {Human (Homo sapiens) [TaxId: 9606]}
pglvdthihasqysfagssidlpllewltkytfpaehrfqnidfaeevytrvvrrtlkng
tttacyfatihtdssllladitdkfgqrafvgkvcmdlndtfpeyketteesiketerfv
semlqknysrvkpivtprfslscsetlmgelgniaktrdlhiqshisenrdeveavknly
psyknytsvydknnlltnktvmahgcylsaeelnvfhergasiahcpnsnlslssgflnv
levlkhevkiglgtdvaggysysmldairravmvsnillinkvneksltlkevfrlatlg
gsqalgldgeign

SCOPe Domain Coordinates for d4aqla2:

Click to download the PDB-style file with coordinates for d4aqla2.
(The format of our PDB-style files is described here.)

Timeline for d4aqla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4aqla1