SCOPe 2.02: Domain d1ajwa_: 1ajw A:

Lineage for d1ajwa_ (1ajw A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49243] (4 PDB entries)

8. Domain d1ajwa_: 1ajw A: [21905]

Details for d1ajwa_

PDB Entry: 1ajw

PDB Description: structure of rhogdi: a c-terminal binding domain targets an n-terminal inhibitory peptide to gtpases, nmr, 20 structures

PDB Compounds: (A:) rhogdi

SCOPe Domain Sequences for d1ajwa_:

Sequence; same for both SEQRES and ATOM records:

>d1ajwa_ b.1.18.8 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Cow (Bos taurus) [TaxId: 9913]}
avsadpnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvn
reivsgmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniks
rftdddrtdhlswewnltikkewkd

Timeline for d1ajwa_:

• d1ajwa_ first appeared (with stable ids) in SCOP 1.55, called d1ajw__
  
• d1ajwa_ appears in SCOPe 2.01
  
• d1ajwa_ appears in SCOPe 2.03
  
• d1ajwa_ appears in the current release, SCOPe 2.08