Lineage for d4ajec1 (4aje C:2-159)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831730Species Norway rat (Rattus norvegicus) [TaxId:10116] [226329] (13 PDB entries)
  8. 1831777Domain d4ajec1: 4aje C:2-159 [218937]
    Other proteins in same PDB: d4ajea2, d4ajeb2, d4ajec2, d4ajed2
    automated match to d9ldta1
    complexed with 2b4, gol, mli

Details for d4ajec1

PDB Entry: 4aje (more details), 2.35 Å

PDB Description: rat ldha in complex with 2-(4-bromophenoxy)propanedioic acid
PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4ajec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ajec1 c.2.1.0 (C:2-159) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgem
mdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiip
nvvkyspqckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d4ajec1:

Click to download the PDB-style file with coordinates for d4ajec1.
(The format of our PDB-style files is described here.)

Timeline for d4ajec1: