Lineage for d4ah7b1 (4ah7 B:2-293)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098336Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2098337Protein automated matches [190115] (75 species)
    not a true protein
  7. 2098835Species Staphylococcus aureus [TaxId:93061] [193178] (7 PDB entries)
  8. 2098859Domain d4ah7b1: 4ah7 B:2-293 [218861]
    Other proteins in same PDB: d4ah7a2, d4ah7b2
    automated match to d4amac_

Details for d4ah7b1

PDB Entry: 4ah7 (more details), 2.3 Å

PDB Description: Structure of Wild Type Stapylococcus aureus N-acetylneuraminic acid lyase in complex with pyruvate
PDB Compounds: (B:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d4ah7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ah7b1 c.1.10.0 (B:2-293) automated matches {Staphylococcus aureus [TaxId: 93061]}
nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvxytapnffllerirkaf
pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

SCOPe Domain Coordinates for d4ah7b1:

Click to download the PDB-style file with coordinates for d4ah7b1.
(The format of our PDB-style files is described here.)

Timeline for d4ah7b1: