SCOPe 2.06: Domain d4afge_: 4afg E:

Lineage for d4afge_ (4afg E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (6 species)
   not a true protein

7. Species Capitella teleta [TaxId:283909] [193507] (3 PDB entries)

8. Domain d4afge_: 4afg E: [218832]
   automated match to d4b5dc_
   complexed with qmr

Details for d4afge_

PDB Entry: 4afg, 2 Å

PDB Description: capitella teleta achbp in complex with varenicline

PDB Compounds: (E:) capitella teleta achbp

SCOPe Domain Sequences for d4afge_:

Sequence; same for both SEQRES and ATOM records:

>d4afge_ b.96.1.0 (E:) automated matches {Capitella teleta [TaxId: 283909]}
nglmakrlrrellntyeqlgksglpflddigkvdvkfglslqllksieqrgmgfnsigtf
kaivklswvdtilrwdpeppfdfqkieispdeiwtpdiklfnsvdldmtldrttqaivfs
ngtvlwippavlkvlcvsqddvdschfqfgswvysvdevdihfmddkaevlldfyqdsle
ilensaqrqevvypccesayvemkyllalrse

Timeline for d4afge_:

• d4afge_ first appeared in SCOPe 2.03
  
• d4afge_ appears in SCOPe 2.05
  
• d4afge_ appears in SCOPe 2.07
  
• d4afge_ appears in the current release, SCOPe 2.08