SCOPe 2.06: Domain d4acsd2: 4acs D:81-220

Lineage for d4acsd2 (4acs D:81-220)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (42 PDB entries)

8. Domain d4acsd2: 4acs D:81-220 [218806]
   Other proteins in same PDB: d4acsa1, d4acsb1, d4acsc1, d4acsd1
   automated match to d1agsa1
   complexed with gsh; mutant

Details for d4acsd2

PDB Entry: 4acs, 2.1 Å

PDB Description: crystal structure of mutant gst a2-2 with enhanced catalytic efficiency with azathioprine

PDB Compounds: (D:) glutathione s-transferase a2

SCOPe Domain Sequences for d4acsd2:

Sequence; same for both SEQRES and ATOM records:

>d4acsd2 a.45.1.1 (D:81-220) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lygkdikekalidmyiegiadlgemigdlsfsqpeeqdaklaliqektknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleesrkif

Timeline for d4acsd2:

• d4acsd2 first appeared in SCOPe 2.03
  
• d4acsd2 appears in SCOPe 2.05
  
• d4acsd2 appears in SCOPe 2.07
  
• d4acsd2 appears in the current release, SCOPe 2.08