Lineage for d1fieb1 (1fie B:10-190)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456484Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 456485Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 456486Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49236] (8 PDB entries)
    Coagulation factor XIII
  8. 456496Domain d1fieb1: 1fie B:10-190 [21880]
    Other proteins in same PDB: d1fiea2, d1fiea3, d1fiea4, d1fieb2, d1fieb3, d1fieb4

Details for d1fieb1

PDB Entry: 1fie (more details), 2.5 Å

PDB Description: recombinant human coagulation factor xiii

SCOP Domain Sequences for d1fieb1:

Sequence, based on SEQRES records: (download)

>d1fieb1 b.1.18.9 (B:10-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme}
grravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtdky
ennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgk
wgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwce
d

Sequence, based on observed residues (ATOM records): (download)

>d1fieb1 b.1.18.9 (B:10-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme}
grravppnnsnaaeddlptvelqgvvpnlqeflnvtsvhlfkerwdtnkvdhhtdkyenn
klivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwga
kivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwced

SCOP Domain Coordinates for d1fieb1:

Click to download the PDB-style file with coordinates for d1fieb1.
(The format of our PDB-style files is described here.)

Timeline for d1fieb1: