Lineage for d4a6ga1 (4a6g A:1-125)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413009Species Amycolatopsis sp. [TaxId:37632] [226521] (1 PDB entry)
  8. 1413010Domain d4a6ga1: 4a6g A:1-125 [218670]
    Other proteins in same PDB: d4a6ga2, d4a6gb2, d4a6gc2, d4a6gd2
    automated match to d1wufa2
    complexed with ame, mg; mutant

Details for d4a6ga1

PDB Entry: 4a6g (more details), 2.71 Å

PDB Description: N-acyl amino acid racemase from Amycalotopsis sp. Ts-1-60: G291D- F323Y mutant in complex with N-acetyl methionine
PDB Compounds: (A:) N-acylamino acid racemase

SCOPe Domain Sequences for d4a6ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a6ga1 d.54.1.0 (A:1-125) automated matches {Amycolatopsis sp. [TaxId: 37632]}
mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
aelgs

SCOPe Domain Coordinates for d4a6ga1:

Click to download the PDB-style file with coordinates for d4a6ga1.
(The format of our PDB-style files is described here.)

Timeline for d4a6ga1: