SCOPe 2.03: Domain d4a6ga2: 4a6g A:126-368

Lineage for d4a6ga2 (4a6g A:126-368)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (45 species)
   not a true protein

7. Species Amycolatopsis sp. [TaxId:37632] [226810] (1 PDB entry)

8. Domain d4a6ga2: 4a6g A:126-368 [218671]
   Other proteins in same PDB: d4a6ga1, d4a6gb1, d4a6gc1, d4a6gd1
   automated match to d1wufa1
   complexed with ame, mg; mutant

Details for d4a6ga2

PDB Entry: 4a6g, 2.71 Å

PDB Description: N-acyl amino acid racemase from Amycalotopsis sp. Ts-1-60: G291D- F323Y mutant in complex with N-acetyl methionine

PDB Compounds: (A:) N-acylamino acid racemase

SCOPe Domain Sequences for d4a6ga2:

Sequence; same for both SEQRES and ATOM records:

>d4a6ga2 c.1.11.0 (A:126-368) automated matches {Amycolatopsis sp. [TaxId: 37632]}
vrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerfgddvl
lqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpicldesivsa
raaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgraanval
aslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevttakvw
igs

Timeline for d4a6ga2:

• d4a6ga2 is new in SCOPe 2.03-stable
  
• d4a6ga2 appears in SCOPe 2.04
  
• d4a6ga2 appears in the current release, SCOPe 2.08