Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (17 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.3: Hemocyanin, C-terminal domain [81283] (1 protein) |
Protein Hemocyanin, C-terminal domain [49228] (2 species) elaborated with many loop insertions in the common fold |
Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [49229] (4 PDB entries) |
Domain d1ll1_3: 1ll1 380-628 [21864] Other proteins in same PDB: d1ll1_1, d1ll1_2 complexed with cl, cu |
PDB Entry: 1ll1 (more details), 2.55 Å
SCOP Domain Sequences for d1ll1_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ll1_3 b.1.18.3 (380-628) Hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus)} pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt vvrhsldssvtlshqptfedllseycscgwpshllvpkgnikgmeyhlfvmltdwdkdkv vacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfhe
Timeline for d1ll1_3: