Lineage for d1ll1_3 (1ll1 380-628)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9683Protein Hemocyanin, C-terminal domain [49228] (2 species)
  7. 9684Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [49229] (4 PDB entries)
  8. 9688Domain d1ll1_3: 1ll1 380-628 [21864]
    Other proteins in same PDB: d1ll1_1, d1ll1_2

Details for d1ll1_3

PDB Entry: 1ll1 (more details), 2.55 Å

PDB Description: hydroxo bridge met form hemocyanin from limulus

SCOP Domain Sequences for d1ll1_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ll1_3 b.1.1.5 (380-628) Hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus)}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllseycscgwpshllvpkgnikgmeyhlfvmltdwdkdkv
vacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfhe

SCOP Domain Coordinates for d1ll1_3:

Click to download the PDB-style file with coordinates for d1ll1_3.
(The format of our PDB-style files is described here.)

Timeline for d1ll1_3: