Lineage for d3zoxc_ (3zox C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981426Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1981427Protein automated matches [190453] (22 species)
    not a true protein
  7. 1981478Species Nitrosomonas europaea [TaxId:915] [224844] (2 PDB entries)
  8. 1981485Domain d3zoxc_: 3zox C: [218385]
    automated match to d1ynrb_
    complexed with hec; mutant

Details for d3zoxc_

PDB Entry: 3zox (more details), 2.1 Å

PDB Description: Crystal Structure of N64Del Mutant of Nitrosomonas europaea Cytochrome c552 (monoclinic space group)
PDB Compounds: (C:) Cytochrome c-552

SCOPe Domain Sequences for d3zoxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zoxc_ a.3.1.0 (C:) automated matches {Nitrosomonas europaea [TaxId: 915]}
dadlakknnciachqvetkvvgpalkdiaakyadkddaatylagkikggssgvwgqipmp
pvnvsdadakaladwiltlk

SCOPe Domain Coordinates for d3zoxc_:

Click to download the PDB-style file with coordinates for d3zoxc_.
(The format of our PDB-style files is described here.)

Timeline for d3zoxc_: