SCOPe 2.03: Domain d3w2ta2: 3w2t A:509-766

Lineage for d3w2ta2 (3w2t A:509-766)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller
   automatically mapped to Pfam PF00326

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82499] (68 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d3w2ta2: 3w2t A:509-766 [218198]
   Other proteins in same PDB: d3w2ta1, d3w2tb1
   automated match to d1j2ea2
   complexed with gol, lf7, nag

Details for d3w2ta2

PDB Entry: 3w2t, 2.36 Å

PDB Description: crystal structure of human depiptidyl peptidase iv (dpp-4) in complex with vildagliptin

PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3w2ta2:

Sequence; same for both SEQRES and ATOM records:

>d3w2ta2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d3w2ta2:

• d3w2ta2 is new in SCOPe 2.03-stable
  
• d3w2ta2 appears in SCOPe 2.04
  
• d3w2ta2 appears in the current release, SCOPe 2.08