Lineage for d2dl2a2 (2dl2 A:102-200)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104725Family b.1.1.4: I set domains [49159] (25 proteins)
  6. 104848Protein Killer cell inhibitory receptor [49202] (3 species)
  7. 104849Species Human (Homo sapiens), 2dl2 [TaxId:9606] [49205] (2 PDB entries)
  8. 104853Domain d2dl2a2: 2dl2 A:102-200 [21804]

Details for d2dl2a2

PDB Entry: 2dl2 (more details), 3 Å

PDB Description: killer immunoglobulin receptor 2dl2

SCOP Domain Sequences for d2dl2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dl2a2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), 2dl2}
tglyekpslsaqpgptvlagesvtlscssrssydmyhlsregeahecrfsagpkvngtfq
adfplgpathggtyrcfgsfrdspyewsnssdpllvsvi

SCOP Domain Coordinates for d2dl2a2:

Click to download the PDB-style file with coordinates for d2dl2a2.
(The format of our PDB-style files is described here.)

Timeline for d2dl2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dl2a1