SCOPe 2.08: Domain d3vpxb1: 3vpx B:1-133

Lineage for d3vpxb1 (3vpx B:1-133)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (40 species)
   not a true protein

7. Species Sporosarcina psychrophila [TaxId:1476] [226586] (1 PDB entry)

8. Domain d3vpxb1: 3vpx B:1-133 [218017]
   Other proteins in same PDB: d3vpxa2, d3vpxb2
   automated match to d1leha2

Details for d3vpxb1

PDB Entry: 3vpx, 2.55 Å

PDB Description: Crystal structure of leucine dehydrogenase from a psychrophilic bacterium Sporosarcina psychrophila.

PDB Compounds: (B:) leucine dehydrogenase

SCOPe Domain Sequences for d3vpxb1:

Sequence; same for both SEQRES and ATOM records:

>d3vpxb1 c.58.1.0 (B:1-133) automated matches {Sporosarcina psychrophila [TaxId: 1476]}
meifkymehqdyeqlvicqdkasglkaiiaihdttlgpalggtrmwtyaseeeaiedalr
largmtyknaaaglnlgggktviignpktdkndemfrafgryieglngryitaedvgtte
admdlinletdyv

Timeline for d3vpxb1:

• d3vpxb1 first appeared in SCOPe 2.03
  
• d3vpxb1 appears in SCOPe 2.07