Lineage for d3vo2b1 (3vo2 B:19-159)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2063096Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2063153Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2063262Protein automated matches [227029] (5 species)
    not a true protein
  7. 2063274Species Maize (Zea mays) [TaxId:4577] [225854] (1 PDB entry)
  8. 2063275Domain d3vo2b1: 3vo2 B:19-159 [217951]
    Other proteins in same PDB: d3vo2a1, d3vo2a2, d3vo2b2
    automated match to d1qfza1
    complexed with fad

Details for d3vo2b1

PDB Entry: 3vo2 (more details), 1.39 Å

PDB Description: Crystal structure of Zea mays leaf ferredoxin-NADP+ reductase III
PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3vo2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vo2b1 b.43.4.2 (B:19-159) automated matches {Maize (Zea mays) [TaxId: 4577]}
tskkqdeglvtnkykpkepyvgrclsntritgddapgetwhmvfstegeipyregqsigi
iadgedkngkphklrlysiassalgdfgdsktvslcvkrlvytndqgeivkgvcsnflcd
lkpgadvkitgpvgkemlmpk

SCOPe Domain Coordinates for d3vo2b1:

Click to download the PDB-style file with coordinates for d3vo2b1.
(The format of our PDB-style files is described here.)

Timeline for d3vo2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vo2b2