Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
Protein automated matches [226871] (15 species) not a true protein |
Species Maize (Zea mays) [TaxId:4577] [226538] (5 PDB entries) |
Domain d3vo1b2: 3vo1 B:155-314 [217948] Other proteins in same PDB: d3vo1a1, d3vo1b1 automated match to d1frna2 complexed with fad |
PDB Entry: 3vo1 (more details), 2 Å
SCOPe Domain Sequences for d3vo1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vo1b2 c.25.1.0 (B:155-314) automated matches {Maize (Zea mays) [TaxId: 4577]} mlmpkdpnatiimlatgtgiapfrsflwkmffeehedykytglawlflgvptsdtllyke elekmkemapdnfrldfavsreqtnaagekmyiqtrmaeykeelwellkkdntyvymcgl kgmekgiddimldlaakdginwldykkqlkkseqwnvevy
Timeline for d3vo1b2: