Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
Protein automated matches [226870] (16 species) not a true protein |
Species Maize (Zea mays) [TaxId:4577] [226539] (5 PDB entries) |
Domain d3vo1a1: 3vo1 A:20-154 [217945] Other proteins in same PDB: d3vo1a2, d3vo1b2 automated match to d1frna1 complexed with fad |
PDB Entry: 3vo1 (more details), 2 Å
SCOPe Domain Sequences for d3vo1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vo1a1 b.43.4.0 (A:20-154) automated matches {Maize (Zea mays) [TaxId: 4577]} skkqeeglvtnkykpkepyvgrcllntritgdqapgetwhmvfstegevpyregqsigvi adgedkngkphklrlysiassalgdfgdsktvslcvkrlvytndqgevvkgvcsnflcdl kpgaevkitgpvgke
Timeline for d3vo1a1: