Lineage for d3vl9b_ (3vl9 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1781937Species Fungus (Aspergillus aculeatus) [TaxId:5053] [195557] (3 PDB entries)
  8. 1781939Domain d3vl9b_: 3vl9 B: [217913]
    automated match to d3vl8a_

Details for d3vl9b_

PDB Entry: 3vl9 (more details), 1.2 Å

PDB Description: crystal structure of xeg-xyloglucan
PDB Compounds: (B:) Xyloglucan-specific endo-beta-1,4-glucanase A

SCOPe Domain Sequences for d3vl9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vl9b_ b.29.1.0 (B:) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
qrrsdfcgqwdtatagdftlyndlwgesagtgsqctgvdsysgdtiawhtswswsggsss
vksyvnaaltftptqlncissipttwkwsysgssivadvaydtflaetasgsskyeimvw
laalggagpisstgstiatptiagvnwklysgpngdttvysfvadsttesfsgdlndfft
ylvdnegvsdelylttleagtepftgsnakltvseysisie

SCOPe Domain Coordinates for d3vl9b_:

Click to download the PDB-style file with coordinates for d3vl9b_.
(The format of our PDB-style files is described here.)

Timeline for d3vl9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3vl9a_