Lineage for d3vg3a1 (3vg3 A:2-127)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2072541Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2072785Protein Liver fatty acid binding protein [50866] (3 species)
  7. 2072790Species Human (Homo sapiens) [TaxId:9606] [141464] (19 PDB entries)
    Uniprot P07148 1-127
  8. 2072799Domain d3vg3a1: 3vg3 A:2-127 [217807]
    Other proteins in same PDB: d3vg3a2, d3vg3a3
    automated match to d3vg7a_
    complexed with cd, plm

Details for d3vg3a1

PDB Entry: 3vg3 (more details), 2.22 Å

PDB Description: Cadmium derivative of human LFABP
PDB Compounds: (A:) Fatty acid-binding protein, liver

SCOPe Domain Sequences for d3vg3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vg3a1 b.60.1.2 (A:2-127) Liver fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
sfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskviqn
eftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdivfk
riskri

SCOPe Domain Coordinates for d3vg3a1:

Click to download the PDB-style file with coordinates for d3vg3a1.
(The format of our PDB-style files is described here.)

Timeline for d3vg3a1: