SCOP 1.65: Domain d1fcga1: 1fcg A:4-88

Lineage for d1fcga1 (1fcg A:4-88)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (29 proteins)

6. Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), IIa [TaxId:9606] [49197] (2 PDB entries)

8. Domain d1fcga1: 1fcg A:4-88 [21779]

Details for d1fcga1

PDB Entry: 1fcg, 2 Å

PDB Description: ectodomain of human fc gamma receptor, fcgriia

SCOP Domain Sequences for d1fcga1:

Sequence; same for both SEQRES and ATOM records:

>d1fcga1 b.1.1.4 (A:4-88) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIa}
appkavlkleppwinvlqedsvtltcqgarspesdsiqwfhngnlipthtqpsyrfkann
ndsgeytcqtgqtslsdpvhltvlf

Timeline for d1fcga1:

• d1fcga1 first appeared (with stable ids) in SCOP 1.55
  
• d1fcga1 appears in SCOP 1.63
  
• d1fcga1 appears in SCOP 1.67
  
• d1fcga1 appears in the current release, SCOPe 2.08