Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (29 proteins) |
Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species) possibly an intermediate structure between the I set and FnIII domains |
Species Human (Homo sapiens), IIa [TaxId:9606] [49197] (2 PDB entries) |
Domain d1fcga1: 1fcg A:4-88 [21779] |
PDB Entry: 1fcg (more details), 2 Å
SCOP Domain Sequences for d1fcga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fcga1 b.1.1.4 (A:4-88) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIa} appkavlkleppwinvlqedsvtltcqgarspesdsiqwfhngnlipthtqpsyrfkann ndsgeytcqtgqtslsdpvhltvlf
Timeline for d1fcga1: