Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein High affinity nerve growth factor receptor TrkA, different domains [49190] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49191] (4 PDB entries) |
Domain d1wwwx_: 1www X: [21773] Other proteins in same PDB: d1wwwv_, d1wwww_ |
PDB Entry: 1www (more details), 2.2 Å
SCOPe Domain Sequences for d1wwwx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwwx_ b.1.1.4 (X:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} vsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetv rhgclrlnqpthvnngnytllaanpfgqasasimaafmdnp
Timeline for d1wwwx_: