Lineage for d3uvte_ (3uvt E:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370432Species Human (Homo sapiens) [TaxId:9606] [188013] (58 PDB entries)
  8. 1370535Domain d3uvte_: 3uvt E: [217544]
    automated match to d2vm1a_
    complexed with so4

Details for d3uvte_

PDB Entry: 3uvt (more details), 2 Å

PDB Description: Crystal structure of the third catalytic domain of ERp46
PDB Compounds: (E:) Thioredoxin domain-containing protein 5

SCOPe Domain Sequences for d3uvte_:

Sequence, based on SEQRES records: (download)

>d3uvte_ c.47.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlaltennfddtiaegitfikfyapwcghcktlaptweelskkefpglagvkiaevdcta
ernicskysvrgyptlllfrggkkvsehsggrdldslhrfvlsqa

Sequence, based on observed residues (ATOM records): (download)

>d3uvte_ c.47.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlaltennfddtiaegitfikfycktlaptweelskkefpglagvkiaevaernicskys
vrgyptlllfrggkkvsehsggrdldslhrfvlsqa

SCOPe Domain Coordinates for d3uvte_:

Click to download the PDB-style file with coordinates for d3uvte_.
(The format of our PDB-style files is described here.)

Timeline for d3uvte_: