Lineage for d2vm1a_ (2vm1 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1368271Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1368552Protein automated matches [190442] (11 species)
    not a true protein
  7. 1368569Species Hordeum vulgare [TaxId:112509] [188425] (2 PDB entries)
  8. 1368570Domain d2vm1a_: 2vm1 A: [168694]
    automated match to d1ti3a_
    complexed with so4

Details for d2vm1a_

PDB Entry: 2vm1 (more details), 1.7 Å

PDB Description: crystal structure of barley thioredoxin h isoform 1 crystallized using ammonium sulfate as precipitant
PDB Compounds: (A:) thioredoxin h isoform 1.

SCOPe Domain Sequences for d2vm1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vm1a_ c.47.1.1 (A:) automated matches {Hordeum vulgare [TaxId: 112509]}
egaviachtkqefdthmangkdtgklviidftaswcgpcrviapvfaeyakkfpgaiflk
vdvdelkdvaeaynveamptflfikdgekvdsvvggrkddihtkivalmg

SCOPe Domain Coordinates for d2vm1a_:

Click to download the PDB-style file with coordinates for d2vm1a_.
(The format of our PDB-style files is described here.)

Timeline for d2vm1a_: