Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Hemolin [49182] (1 species) Duplication: tandem repeat of 4 domains, known as L1 domains |
Species Moth (Hyalophora cecropia) [TaxId:7123] [49183] (1 PDB entry) |
Domain d1biha2: 1bih A:99-209 [21753] complexed with po4 |
PDB Entry: 1bih (more details), 3.1 Å
SCOPe Domain Sequences for d1biha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} yliaspakthektpiegrpfqldcvlpnaypkplitwkkrlsgadpnadvtdfdrritag pdgnlyftivtkedvsdiykyvctaknaavdeevvlveyeikgvtkdnsgy
Timeline for d1biha2:
View in 3D Domains from other chains: (mouse over for more information) d1bihb1, d1bihb2, d1bihb3, d1bihb4 |