Lineage for d3ujrb1 (3ujr B:1-139)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1904961Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1905012Protein Enolase [54828] (9 species)
  7. 1905056Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (9 PDB entries)
    Uniprot P09104
  8. 1905064Domain d3ujrb1: 3ujr B:1-139 [217431]
    Other proteins in same PDB: d3ujra2, d3ujrb2
    automated match to d1pdza2
    complexed with 2pg, mg, pep, trs

Details for d3ujrb1

PDB Entry: 3ujr (more details), 1.4 Å

PDB Description: asymmetric complex of human neuron specific enolase-5-pga/pep
PDB Compounds: (B:) Gamma-enolase

SCOPe Domain Sequences for d3ujrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ujrb1 d.54.1.1 (B:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

SCOPe Domain Coordinates for d3ujrb1:

Click to download the PDB-style file with coordinates for d3ujrb1.
(The format of our PDB-style files is described here.)

Timeline for d3ujrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ujrb2