Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
Protein Enolase [54828] (10 species) |
Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (15 PDB entries) Uniprot P09104 |
Domain d3ucda1: 3ucd A:1-139 [217286] Other proteins in same PDB: d3ucda2, d3ucdb2 automated match to d1pdza2 complexed with 2pg, mg, pep |
PDB Entry: 3ucd (more details), 1.41 Å
SCOPe Domain Sequences for d3ucda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ucda1 d.54.1.1 (A:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} siqkiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka gaaerelplyrhiaqlagn
Timeline for d3ucda1: