Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (29 proteins) |
Protein Twitchin [49174] (2 species) |
Species Human (Homo sapiens), Ig repeat 27 [TaxId:9606] [49176] (2 PDB entries) |
Domain d1tit__: 1tit - [21716] |
PDB Entry: 1tit (more details)
SCOP Domain Sequences for d1tit__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tit__ b.1.1.4 (-) Twitchin {Human (Homo sapiens), Ig repeat 27} lievekplygvevfvgetahfeielsepdvhgqwklkgqpltaspdceiiedgkkhilil hncqlgmtgevsfqaanaksaanlkvkel
Timeline for d1tit__: