Lineage for d1tit__ (1tit -)
- Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.1: Immunoglobulin [48726] (4 families) 
Family b.1.1.4: I set domains [49159] (29 proteins) 
Protein Twitchin [49174] (2 species) 
Species Human (Homo sapiens), Ig repeat 27 [TaxId:9606] [49176] (2 PDB entries) 
Domain d1tit__: 1tit - [21716]
Details for d1tit__
PDB Entry: 1tit (more details)
PDB Description: titin, ig repeat 27, nmr, minimized average structure
SCOP Domain Sequences for d1tit__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tit__ b.1.1.4 (-) Twitchin {Human (Homo sapiens), Ig repeat 27}
lievekplygvevfvgetahfeielsepdvhgqwklkgqpltaspdceiiedgkkhilil
hncqlgmtgevsfqaanaksaanlkvkel
SCOP Domain Coordinates for d1tit__:
Click to download the PDB-style file with coordinates for d1tit__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tit__:
- d1tit__ first appeared (with stable ids) in SCOP 1.55
- d1tit__ appears in SCOP 1.63
- d1tit__ appears in SCOP 1.67
- d1tit__ appears in the current release, SCOPe 2.08, called d1tita_
View in 3D