Lineage for d1bqsa2 (1bqs A:91-209)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1518665Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1518946Protein Mucosal addressin cell adhesion molecule-1 (MADCAM-1) [49168] (1 species)
  7. 1518947Species Human (Homo sapiens) [TaxId:9606] [49169] (2 PDB entries)
  8. 1518951Domain d1bqsa2: 1bqs A:91-209 [21705]
    complexed with ndg

Details for d1bqsa2

PDB Entry: 1bqs (more details), 2.2 Å

PDB Description: the crystal structure of mucosal addressin cell adhesion molecule-1 (madcam-1)
PDB Compounds: (A:) protein (mucosal addressin cell adhesion molecule-1)

SCOPe Domain Sequences for d1bqsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqsa2 b.1.1.4 (A:91-209) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeee
eepqgdedvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvlhsptspe

SCOPe Domain Coordinates for d1bqsa2:

Click to download the PDB-style file with coordinates for d1bqsa2.
(The format of our PDB-style files is described here.)

Timeline for d1bqsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bqsa1