SCOPe 2.05: Domain d3tp0a1: 3tp0 A:24-93

Lineage for d3tp0a1 (3tp0 A:24-93)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Ethr repressor [109651] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109652] (10 PDB entries)
   Uniprot P96222 22-215

8. Domain d3tp0a1: 3tp0 A:24-93 [216944]
   Other proteins in same PDB: d3tp0a2
   automated match to d1t56a1
   protein/DNA complex; complexed with fo5

Details for d3tp0a1

PDB Entry: 3tp0, 1.9 Å

PDB Description: structural activation of the transcriptional repressor ethr from m. tuberculosis by single amino-acid change mimicking natural and synthetic ligands

PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d3tp0a1:

Sequence; same for both SEQRES and ATOM records:

>d3tp0a1 a.4.1.9 (A:24-93) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
drelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvnqa
dmalqtlaen

Timeline for d3tp0a1:

• d3tp0a1 first appeared in SCOPe 2.03
  
• d3tp0a1 appears in SCOPe 2.04
  
• d3tp0a1 appears in SCOPe 2.06
  
• d3tp0a1 appears in the current release, SCOPe 2.08