SCOPe 2.05: Domain d1ic1b2: 1ic1 B:1-82

Lineage for d1ic1b2 (1ic1 B:1-82)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Intercellular adhesion molecule-1, ICAM-1 [49162] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49163] (6 PDB entries)

8. Domain d1ic1b2: 1ic1 B:1-82 [21691]
   Other proteins in same PDB: d1ic1a1, d1ic1b1
   D1
   complexed with nag

Details for d1ic1b2

PDB Entry: 1ic1, 3 Å

PDB Description: the crystal structure for the n-terminal two domains of icam-1

PDB Compounds: (B:) intercellular adhesion molecule-1

SCOPe Domain Sequences for d1ic1b2:

Sequence; same for both SEQRES and ATOM records:

>d1ic1b2 b.1.1.4 (B:1-82) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]}
qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
sqpmcysncpdgqstaktfltv

Timeline for d1ic1b2:

• d1ic1b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ic1b2 appears in SCOPe 2.04
  
• d1ic1b2 appears in SCOPe 2.06
  
• d1ic1b2 appears in the current release, SCOPe 2.08