Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
Domain d3tnnd1: 3tnn D:4-108 [216898] Other proteins in same PDB: d3tnnb2, d3tnnd2, d3tnnf2, d3tnnl2 automated match to d1aqkl1 complexed with cl, gol, so4 |
PDB Entry: 3tnn (more details), 1.95 Å
SCOPe Domain Sequences for d3tnnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tnnd1 b.1.1.0 (D:4-108) automated matches {Human (Homo sapiens) [TaxId: 9606]} altqpasvsgspgqsitisctgtssdvgsynfvswyqqhpgkapklmiyevserpsgisn rfsgsksgntasltisglqaedeadyycssyagsttfrvfgggtkltvrg
Timeline for d3tnnd1: