Lineage for d3tgba_ (3tgb A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1799772Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1800065Protein Nitrophorin 4 [50845] (1 species)
  7. 1800066Species Rhodnius prolixus [TaxId:13249] [50846] (44 PDB entries)
    Uniprot Q94734 22-205
  8. 1800096Domain d3tgba_: 3tgb A: [216812]
    automated match to d3tgca_
    complexed with hem, imd; mutant

Details for d3tgba_

PDB Entry: 3tgb (more details), 1.35 Å

PDB Description: Crystal structure of L130R mutant of Nitrophorin 4 from Rhodnius prolixus complexed with imidazole at pH 7.4
PDB Compounds: (A:) Nitrophorin-4

SCOPe Domain Sequences for d3tgba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tgba_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdrgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

SCOPe Domain Coordinates for d3tgba_:

Click to download the PDB-style file with coordinates for d3tgba_.
(The format of our PDB-style files is described here.)

Timeline for d3tgba_: