Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Sinorhizobium meliloti [TaxId:266834] [189876] (13 PDB entries) |
Domain d3tfoc_: 3tfo C: [216793] Other proteins in same PDB: d3tfoa2 automated match to d1xg5a_ complexed with hez, so4 |
PDB Entry: 3tfo (more details), 2.08 Å
SCOPe Domain Sequences for d3tfoc_:
Sequence, based on SEQRES records: (download)
>d3tfoc_ c.2.1.0 (C:) automated matches {Sinorhizobium meliloti [TaxId: 266834]} dkvilitgasggigegiarelgvagakillgarrqarieaiateirdaggtalaqvldvt drhsvaafaqaavdtwgridvlvnnagvmplsplaavkvdewermidvnikgvlwgigav lpimeaqrsgqiinigsigalsvvptaavycatkfavraisdglrqestnirvtcvnpgv veselagtitheetmaamdtyraialqpadiaravrqvieapqsvdtteitirptasgn
>d3tfoc_ c.2.1.0 (C:) automated matches {Sinorhizobium meliloti [TaxId: 266834]} dkvilitgasggigegiarelgvagakillgarrqarieaiateirdaggtalaqvldvt drhsvaafaqaavdtwgridvlvnnagvmplsplaavkvdewermidvnikgvlwgigav lpimeaqrsgqiinigsigalsvvptaavycatkfavraisdglrqestnirvtcvnpgv valqpadiaravrqvieapqsvdtteitirptasgn
Timeline for d3tfoc_:
View in 3D Domains from other chains: (mouse over for more information) d3tfoa1, d3tfoa2, d3tfob_, d3tfod_ |