SCOPe 2.06: Domain d3td3h1: 3td3 H:221-339

Lineage for d3td3h1 (3td3 H:221-339)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.7: OmpA-like [103088] (2 families)

5. Family d.79.7.0: automated matches [195454] (1 protein)
   not a true family

6. Protein automated matches [195455] (11 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [224937] (5 PDB entries)

8. Domain d3td3h1: 3td3 H:221-339 [216756]
   Other proteins in same PDB: d3td3a2, d3td3b2, d3td3c2, d3td3d2, d3td3e2, d3td3f2, d3td3g2, d3td3h2
   automated match to d2hqsc_
   complexed with gly

Details for d3td3h1

PDB Entry: 3td3, 1.59 Å

PDB Description: Crystal structure of OmpA-like domain from Acinetobacter baumannii in complex with glycine

PDB Compounds: (H:) Outer membrane protein omp38

SCOPe Domain Sequences for d3td3h1:

Sequence; same for both SEQRES and ATOM records:

>d3td3h1 d.79.7.0 (H:221-339) automated matches {Acinetobacter baumannii [TaxId: 470]}
eltedlnmelrvffdtnksnikdqykpeiakvaeklseypnatarieghtdntgprklne
rlslaransvksalvneynvdasrlstqgfawdqpiadnktkegramnrrvfatitgsr

Timeline for d3td3h1:

• d3td3h1 first appeared in SCOPe 2.03, called d3td3h_
  
• d3td3h1 was called d3td3h_ in SCOPe 2.05
  
• d3td3h1 appears in SCOPe 2.07
  
• d3td3h1 appears in the current release, SCOPe 2.08